-
Notifications
You must be signed in to change notification settings - Fork 14
New issue
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
Add curriculum learning strategy #39
Comments
sounds cool. i can give it a shot! |
/take |
I assume we are going to create a custom DataLoader for this? |
I am also interested to help for this problem. Shall we work together @talkhanz ? |
/take |
Thank you @talkhanz and @Leo-T-Zang ! Updated the issue with various possible curriculum schemes we discussed today. Will let you decide which scheme(s) you prefer working on :) |
Hey @Leo-T-Zang sounds good . I can work on the sequence length wise scheme and maybe you can pick any of the other two. We should probably agree on an approach to avoid merge conflicts. Perhaps a main CurriculumLearning class with strategy as an a attribute to decide which scheme is applied underhood? |
Sure, can we talk over discord? What is your username? |
same as my github |
@pascalnotin just to update, we've finalized our approach and a PR (for strategy=sequence_length) should emerge quickly once I figure out a good unit test for this |
Hi, to follow up on my suggestion in the talk: We could use some entropy based (or generally info-theory) metric to assess a given sequence. I just quickly skipped google and the shannon entroppy seems to use either a probability matrix of AAs over a large sequence set or an MSA. Another idea that was shortly discussed, is to employ an algorithm that searches for repeats of any kind and use this information to build a curriculum. However, a general question that comes to mind (which could be obvious to some of you, as I did not work much with proteins) I'll be looking forward tpo the discussion :) @pascalnotin should I include this in the discord? |
Hi Max - looking forward to hearing more about the sequence-only entropy based metric. I think we want to stay away from anything that would be based on MSAs for this. Looking for motifs could be interesting -- perhaps something based on: 1) counting the frequent k-mers in the full corpus (we can rely on the fast procedures used in BPE for that) 2) counting the instances of these common k-mers for each sequence. |
the k-mers idea sound good! To go in the shannon entropy direction: |
My collaeagues from the IDR side, suggested, that since the complexity of a sequence is very different throughout the seq, that a sliding window would make sense. This package: https://pappulab.github.io/localCIDER/ |
I have a proposal based on the "intrinsic dimension" of the embeddings of a pre-trained protein language model. This would require computing embeddings of proteins using a pLM, and then computing the intrinsic dimension of those embeddings as a measure of complexity. As a reference, this was used to detect AI generated text (and might be used similarly for proteins). A good reference is this paper: https://arxiv.org/abs/2306.04723 |
This can be computed as follows: import numpy as np
from sklearn.linear_model import LinearRegression
from transformers import AutoTokenizer, AutoModel, EsmModel
import torch
from scipy.sparse.csgraph import minimum_spanning_tree
# Load the tokenizer and model
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D")
model = EsmModel.from_pretrained("facebook/esm2_t6_8M_UR50D")
# Input text
text = "MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE"
# Tokenize the input and convert to tensors
inputs = tokenizer(text, return_tensors='pt')
# Get the embeddings
with torch.no_grad():
outputs = model(**inputs)
embeddings = outputs.last_hidden_state[0].numpy()
# Remove the first and last embeddings (<CLS> and <EOS>)
embeddings = embeddings[1:-1]
# Sizes for the subsets to sample
sizes = np.linspace(2, len(embeddings), num=100, dtype=int)
# Prepare data for linear regression
x = []
y = []
for size in sizes:
# Sample a subset of the embeddings
subset = np.random.choice(len(embeddings), size, replace=False)
subset_embeddings = embeddings[subset]
# Compute the distance matrix
dist_matrix = np.sqrt(np.sum((subset_embeddings[:, None] - subset_embeddings)**2, axis=-1))
# Compute the minimum spanning tree
mst = minimum_spanning_tree(dist_matrix).toarray()
# Calculate the persistent score E (the maximum edge length in the MST)
E = np.max(mst)
# Append to the data for linear regression
x.append(np.log(size))
y.append(np.log(E))
# Reshape for sklearn
X = np.array(x).reshape(-1, 1)
Y = np.array(y).reshape(-1, 1)
# Linear regression
reg = LinearRegression().fit(X, Y)
# Estimated Persistent Homology Dimension
phd = 1 / (1 - reg.coef_[0][0])
print(phd) This is an attempt at an implementation of the estimation of Persistent Homology Dimension described in Intrinsic Dimension Estimation for Robust Detection of AI-Generated Texts. This is a fractal dimension that aims to detect protein sequences generated by AI, but could also be considered a type of complexity measure for each protein sequence.
In summary, the code is estimating the 0-dimensional Persistent Homology Dimension of the manifold |
Hi Amelie, Thanks for the input! And directly with implementation even! :D This will also likely he helpful for my aforementioned colleagues:) But generally Isn't this a bit much to run inference on our complete corpus to allow for better training? |
Yes, you're probably right. There was talk of using ESM-2 as a way of scoring complexity of proteins, so it seemed relevant. But it could be a bit overkill to do this for every protein in the training data. I guess I don't have a good understanding of the compute necessary to do it this way either. |
Hm... perhaps @NZ99 has some better idea about the compute necessary here than us? Also @talkhanz @Leo-T-Zang do you think your data collator updates could be reused with amelies code and some implementation of the single sequence entropy idea? |
great work guys. the integration for any new CL metric is straightforward, we need to use this function
to set the metric column of a dataset according to our logic. The input_column_name will be the column referring to the column containing our sequences while curriculum_column_name will refer to the new column hosting our metric values. Effectively we are precomputing a new column to be appended to the dataset The rest is handled by the Trainer. and set the arguments appropriately at protein-lm-scaling/protein_lm/configs/train/toy_localcsv.yaml Lines 11 to 13 in 0e48cff
or protein-lm-scaling/protein_lm/configs/train/toy_hf.yaml Lines 11 to 13 in 0e48cff
|
@Muedi, Yes, I think we can simply add them as @talkhanz described. Current CL strategy also supports continous values like perplexity, plDDT. So for entropy and intricate dimension, it should also work. Given all these continous values are computing intensive, I would suggest to precompute them and store with dataset, so we can use them later. |
If there is a publication that anyone is working on, I would be happy to contribute a write-up of the intrinsic dimension and its use to determine the complexity of the proteins. Just let me know and I will start working in this. |
So If I wanted to implement these, the best course of action would be functions in a utility script and then connect to the dataset people? |
Hi @Muedi @Amelie-Schreiber -- thanks for the great suggestions above! To contribute the ideas within the codebase, you would need to create a PR similar to the one that @Leo-T-Zang just created for ppl and plddt, building on the original PR from @talkhanz. Besides the changes to the codebase (dataset.py in particular) and the test routine, there would be a separate script needed to pre-compute the complexity metrics that you defined above (with a separate test routine). Let me know if that makes sense! |
For posterity and in case someone else gets to this before me, we should make the function for estimating the intrinsic dimension using PHD as follows I think: import numpy as np
from sklearn.linear_model import LinearRegression
from transformers import AutoTokenizer, AutoModel, EsmModel
import torch
from scipy.sparse.csgraph import minimum_spanning_tree
# Load the tokenizer and model
model_path = "facebook/esm2_t6_8M_UR50D"
tokenizer = AutoTokenizer.from_pretrained(model_path)
model = EsmModel.from_pretrained(model_path)
def estimate_persistent_homology_dimension_avg(sequence, num_subsets, num_iterations):
"""
Estimate the persistent homology dimension of a given protein sequence.
Parameters:
- sequence: A string representing the protein sequence.
- num_subsets: A positive integer indicating the number of subsets of the embedding vectors to use. Max of 2**n where n=len(sequence).
- num_iterations: A positive integer indicating the number of iterations for averaging.
Returns:
- avg_phd: Average estimated persistent homology dimension.
"""
phd_values = [] # List to store PHD values for each iteration
for _ in range(num_iterations):
# Tokenize the input and convert to tensors
inputs = tokenizer(sequence, return_tensors='pt')
# Get the embeddings
with torch.no_grad():
outputs = model(**inputs)
embeddings = outputs.last_hidden_state[0].numpy()
# Remove the first and last embeddings (<CLS> and <EOS>)
embeddings = embeddings[1:-1]
# Sizes for the subsets to sample
sizes = np.linspace(2, len(embeddings), num=num_subsets, dtype=int)
# Prepare data for linear regression
x = []
y = []
for size in sizes:
# Sample a subset of the embeddings
subset = np.random.choice(len(embeddings), size, replace=False)
subset_embeddings = embeddings[subset]
# Compute the distance matrix
dist_matrix = np.sqrt(np.sum((subset_embeddings[:, None] - subset_embeddings)**2, axis=-1))
# Compute the minimum spanning tree
mst = minimum_spanning_tree(dist_matrix).toarray()
# Calculate the persistent score E (the maximum edge length in the MST)
E = np.max(mst)
# Append to the data for linear regression
x.append(np.log(size))
y.append(np.log(E))
# Reshape for sklearn
X = np.array(x).reshape(-1, 1)
Y = np.array(y).reshape(-1, 1)
# Linear regression
reg = LinearRegression().fit(X, Y)
# Estimated Persistent Homology Dimension for this iteration
phd = 1 / (1 - reg.coef_[0][0])
phd_values.append(phd)
avg_phd = np.mean(phd_values) # Average over all iterations
return avg_phd
# Example usage:
protein_sequence = "MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE"
estimated_dimension_avg = estimate_persistent_homology_dimension_avg(protein_sequence, 10, 20)
estimated_dimension_avg I'm not sure if there is any benefit to using larger models than |
Hi Amelie, why do you propose to use subsets instead of taking the complete sequence here? I planned to get some coding time for this either tomorrow or on Friday, if you want I can notify you, so that we do not do double work. |
I'm just following the recipe in the paper. I'm going to have to try digging a little deeper into the references in the paper to really understand why this estimate is an estimate of intrinsic dimension. The concept actually feels quite difficult to me depending on the day I'm looking at it. I know the averaging is a way of stabilizing the estimation of the dimension, which has high variance as you mentioned. It's a kind of fractal dimension and different subsets will have different dimension that go from local to global dimension if I am understanding the paper correctly. The example they give in the paper is of a spiral galaxy type point cloud where the small neighborhoods of the arms are closer to 1-dimensional, and larger neighborhoods closer to the center become two dimensional making the dimension somewhere between 1 and 2. The sizes of the subsets are supposed to vary and be from a uniform distribution. The idea is to have a growing subset size to estimate the dimension at different resolutions. They give a more detailed algorithm in the appendix that is more specific than this with the hyperparameters they found best in their experiments. I don't know if these hyperparameters are best for proteins though. I haven't really had the chance to test the intrinsic dimensions of a lot of proteins yet. It's definitely on my list of things to do. |
Just thought I would post this info here. This might be a better implementation than mine. It seems like there are various methods to estimate intrinsic dimension and that there are connections to generalizability. Also, I found this references: paper reference. This reference has an implementation for the GPU computation of persistent homology dimension which can be found here. There is also a non-GPU implementation. I've also written a more faithful version following the algorithm in the Appendix of the first paper I provided, I'll post it in a bit. |
Just in case it is needed, here is the version that replicates the algorithm in the Appendix of Intrinsic Dimension Estimation for Robust Detection of AI-Generated Texts. Please check this in case I made any silly errors: import numpy as np
from sklearn.linear_model import LinearRegression
from scipy.spatial import distance_matrix
from scipy.sparse.csgraph import minimum_spanning_tree
from transformers import AutoTokenizer, AutoModel
import torch
def get_embeddings(text, model_name="facebook/esm2_t6_8M_UR50D"):
"""
Compute embeddings for each token in the text using a specified model.
Parameters:
- text (str): The input text for which embeddings need to be computed.
- model_name (str): The path to the pretrained model.
Returns:
- numpy.ndarray: A matrix where each row is the embedding of a token in the text.
"""
tokenizer = AutoTokenizer.from_pretrained(model_name)
model = AutoModel.from_pretrained(model_name)
inputs = tokenizer(text, return_tensors="pt", truncation=True, padding=True, max_length=1024)
with torch.no_grad():
outputs = model(**inputs)
# Return embeddings after removing <cls> and <eos> tokens and converting to numpy.
return outputs.last_hidden_state[:, 1:-1, :].squeeze(0).numpy()
def compute_persistent_score(embeddings):
"""
Compute the persistent score for a subset of embeddings using the sum of edge weights in the MST.
Parameters:
- embeddings (numpy.ndarray): A matrix where each row is an embedding.
Returns:
- float: The persistent score for the embeddings.
"""
dist_matrix = distance_matrix(embeddings, embeddings)
mst = minimum_spanning_tree(dist_matrix)
return mst.sum()
def sample_and_score(embeddings, n, k=8, hat_n=40, J=7):
"""
For various sample sizes, compute the median persistent score across J samples.
Parameters:
- embeddings (numpy.ndarray): A matrix where each row is an embedding.
- n (int): Total number of embeddings.
- k (int): Number of different sample sizes.
- hat_n (int): A parameter for determining sample sizes.
- J (int): Number of samples for each sample size.
Returns:
- list: List of sample sizes.
- list: List of corresponding median persistent scores.
"""
scores = []
sizes = [(i - 1) * (n - hat_n) // k + hat_n for i in range(1, k + 1)]
for size in sizes:
subset_scores = [compute_persistent_score(embeddings[np.random.choice(n, size, replace=False)])
for _ in range(J)]
scores.append(np.median(subset_scores))
return sizes, scores
def estimate_dimension(sizes, scores):
"""
Estimate the intrinsic dimension of the data using linear regression on log-transformed sizes and scores.
Parameters:
- sizes (list): List of sample sizes.
- scores (list): List of corresponding median persistent scores.
Returns:
- float: Estimated dimension of the data.
"""
log_sizes = np.log(sizes).reshape(-1, 1)
log_scores = np.log(scores)
reg = LinearRegression().fit(log_sizes, log_scores)
slope = reg.coef_[0]
return 1 / (1 - slope)
def estimate_text_dimension(text, runs=3):
"""
Estimate the intrinsic dimension of the text by repeatedly sampling subsets of its tokens,
computing their persistent scores, and then using linear regression on the log-transformed values.
Parameters:
- text (str): The input text for which the dimension needs to be estimated.
- runs (int): Number of runs with different random seeds.
Returns:
- float: Estimated dimension of the text.
"""
embeddings = get_embeddings(text)
n = embeddings.shape[0]
slopes = []
for _ in range(runs):
sizes, scores = sample_and_score(embeddings, n)
log_sizes = np.log(sizes).reshape(-1, 1)
log_scores = np.log(scores)
reg = LinearRegression().fit(log_sizes, log_scores)
slopes.append(reg.coef_[0])
kappa_F = np.mean(slopes)
return 1 / (1 - kappa_F)
text = "MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE"
dimension = estimate_text_dimension(text)
print(f"Estimated dimension of the text: {dimension}") We could also use TwoNN which is implemented here: https://scikit-dimension.readthedocs.io/en/latest/ |
Adapt sequence sampling throughout training so that we first train on "simpler sequences" and then on more and more "complexe" sequences. We discussed three different types of strategies depending on how complexity is defined:
The text was updated successfully, but these errors were encountered: