-
Notifications
You must be signed in to change notification settings - Fork 10
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
ENH Switch to ONNX for model storage
This will avoid warnings related to version mismatches (e.g., #59) Retrained models to fix off by one error in feature indexing too This changes results, but probabilities are 0.89 correlated (Spearman) with previous version Alas, macrel now requires a recent(ish) version of onnxruntime which means that Python 3.6 and 3.7 are no longer tested. OTOH, we now test on 3.12 as well
- Loading branch information
Showing
22 changed files
with
968 additions
and
949 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Binary file not shown.
Binary file not shown.
Binary file not shown.
Binary file not shown.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1 +1 @@ | ||
__version__ = '1.5.0' | ||
__version__ = '1.6.0.dev0' |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,4 +1,6 @@ | ||
# Prediction from macrel v1.5.0 | ||
# Prediction from macrel v1.6.0.dev0 | ||
Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability | ||
smORF_2 RFLIKMVKVNLMNGKLIRKISLM CLP 0.634 Hemo 0.871 | ||
smORF_19 FFNDGKGTIYYGIKKYFRIYF CLP 0.673 Hemo 0.822 | ||
smORF_0 KVIKKVVAALMVLGALAALTVGVVLKPGRKGDET CLP 0.554 Hemo 0.772 | ||
smORF_2 RFLIKMVKVNLMNGKLIRKISLM CLP 0.733 Hemo 0.921 | ||
smORF_19 FFNDGKGTIYYGIKKYFRIYF CLP 0.634 Hemo 0.762 | ||
smORF_22 TIVVKKVPKCLRGIVKLLFGIKEKWYEKRGYSYSLYFLFVYLL CDP 0.505 Hemo 0.871 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,4 +1,4 @@ | ||
# Prediction from macrel v1.5.0 | ||
# Prediction from macrel v1.6.0.dev0 | ||
# Macrel calculated for the sample a density of 0.000 AMPs / Mbp. | ||
contig length ORFs smORFs AMPs | ||
scaffold2530_2_MH0058 1324 1 0 0 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,2 +1,2 @@ | ||
# Prediction from macrel v1.5.0 | ||
# Prediction from macrel v1.6.0.dev0 | ||
Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,4 +1,6 @@ | ||
# Prediction from macrel v1.5.0 | ||
# Prediction from macrel v1.6.0.dev0 | ||
Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability | ||
scaffold75334_1_MH0058_1 RFLIKMVKVNLMNGKLIRKISLM CLP 0.634 Hemo 0.871 | ||
scaffold33693_17_MH0058_2 FFNDGKGTIYYGIKKYFRIYF CLP 0.673 Hemo 0.822 | ||
scaffold2530_2_MH0058_1 KVIKKVVAALMVLGALAALTVGVVLKPGRKGDET CLP 0.554 Hemo 0.772 | ||
scaffold75334_1_MH0058_1 RFLIKMVKVNLMNGKLIRKISLM CLP 0.733 Hemo 0.921 | ||
scaffold33693_17_MH0058_2 FFNDGKGTIYYGIKKYFRIYF CLP 0.634 Hemo 0.762 | ||
scaffold77554_3_MH0058_7 TIVVKKVPKCLRGIVKLLFGIKEKWYEKRGYSYSLYFLFVYLL CDP 0.505 Hemo 0.871 |
Oops, something went wrong.